CQFD
ce forum est desormais fermé
toute nouvelle inscription est impossible

je ne peux plus m'en occuper, et n'en ai plus la motivation sous cette forme disons
de plus beaucoup trop de liens sont mort et beaucoup de son contenu est obsolète a mes yeux
ce serait donc trop long de rectifier tout ça
je donnerai quelques conseils de temps autres si on me demande, depuis mon tumblr http://mylydy.tumblr.com/
merci a tous les participants qui ont contribué a son contenu (toujours accessible neanmoins)
merci a tout les modos et admin qui m'ont aidé a le faire se developper autant, ce fut une tres belle aventure!

tchao!
mylydy



 
AccueilAccueil  FAQFAQ  RechercherRechercher  Rechercher via GoogleRechercher via Google  S'enregistrerS'enregistrer  ConnexionConnexion  

Partagez | 
 

 STORY BOARD

Voir le sujet précédent Voir le sujet suivant Aller en bas 
Aller à la page : Précédent  1, 2, 3 ... , 10, 11, 12  Suivant
AuteurMessage
Sovelis
Paprikadmin
Paprikadmin
avatar

Messages : 3591
Date d'inscription : 12/01/2012
Age : 24
Localisation : Paris

MessageSujet: Re: STORY BOARD   25/6/2015, 11:23

hell yeah :D

- - - - - - - - - - - - - - -
Tumblr, Twitter, Pinterest
The Polywave, C'est bien quand c'est court, Les Croqueurs
Revenir en haut Aller en bas
http://nathanotano.blogspot.fr/
arina
Krilin
Krilin
avatar

Messages : 601
Date d'inscription : 05/03/2012
Age : 24

MessageSujet: Re: STORY BOARD   25/6/2015, 12:04

Merciii :')
Revenir en haut Aller en bas
http://arinakorczynski.blogspot.fr/
Lifaens
fuck you, I'm Jackie
fuck you, I'm Jackie
avatar

Messages : 376
Date d'inscription : 07/06/2014
Localisation : Lille

Feuille de personnage
Nom ::
Description ::
PV:
7/7  (7/7)

MessageSujet: Re: STORY BOARD   25/6/2015, 12:08

wddcsdfrgthyjukiyujh

merci ^^'
Revenir en haut Aller en bas
http://pierrelesca.blogspot.fr/
dolerf
Bernard Minet
Bernard Minet
avatar

Messages : 244
Date d'inscription : 28/06/2013

Feuille de personnage
Nom ::
Description ::
PV:
7/7  (7/7)

MessageSujet: Re: STORY BOARD   25/6/2015, 17:01

Oh trop cool, merci !
Revenir en haut Aller en bas
http://danderdolerf.blogspot.com
allartthomas
Framboisier
Framboisier
avatar

Messages : 16
Date d'inscription : 28/04/2013

MessageSujet: Re: STORY BOARD   26/6/2015, 15:42

Tiens , c'est marrant !

j'avais bossé avec Thomas sur Atom , chez sipanimation .

j'avais fait trois épisodes . C'était vraiment excellent de bosser avec lui ! 
et l'équipe de boardeurs était super ! une très bonne ambiance dans le studio .

c'est là que j'avais découvert l'utilisation intensive du post-it , avant l'ère Toon boom .

(on était en 2006 je crois) .
Revenir en haut Aller en bas
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   26/6/2015, 15:47

ah vous vous conaissez :D ? :D trop cool je vais lui parler de toi :)
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
allartthomas
Framboisier
Framboisier
avatar

Messages : 16
Date d'inscription : 28/04/2013

MessageSujet: Re: STORY BOARD   26/6/2015, 15:48

toi aussi tu le connais ?...

tu as déjà bossé avec lui ?...

donne lui le bonjour de ma part ! :))
Revenir en haut Aller en bas
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   26/6/2015, 15:50

c'est mon copain ^^' 
oui j'ai bossé un an sur la serie qu'il realise (ladybug)
ok je transmet! :)

(dsl les gens pr le dial privé en plein thread)
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
allartthomas
Framboisier
Framboisier
avatar

Messages : 16
Date d'inscription : 28/04/2013

MessageSujet: Re: STORY BOARD   26/6/2015, 15:53

ah! ah! ok !

super ! 

oui désolé pour la digression ...
Revenir en haut Aller en bas
kaze
Bienveillant_admin
Bienveillant_admin
avatar

Messages : 1371
Date d'inscription : 02/01/2011
Localisation : Toulouse

MessageSujet: Re: STORY BOARD   7/8/2015, 13:21

Salut :)

Je vais faire un test de board pour mardi (Merci les bon plans Mylydy ^^ ) Ca sera sur place, faut que je me deplace là bas . Ca serait pour bosser pour cette série : http://www.teamto.com/en/les-productions/les-productions-de-teamto/mon-chevalier-et-moi/ . Du coup je dois pas mal m' entraîner jusque là .
Forcément je me pose quelques questions, pas grand chose pour l' instant, mais d' autres viendront surement, donc je poste ici . Et ça pourra surement être utile à d' autres gens .

Alors déjà je me demandais si lors des tests, les gens étaient vraiment intransigeants par rapport à ta capacité à reprendre le model sheet en restant bien fidèle ? Je sais qu' évidemment, c' est important de bien être fidèle au model sheet, mais quand on fait le test, mais on est pas sur la série depuis plusieurs semaines, on a pas encore bien pris l' habitude des personnages quoi .
Donc je me demandais si il fallait que j' essaie de m' entrainer sur le perso du trailer (dont le design à ptet changé depuis) ou si c' était une perte de temps .

Autre question :
L' un d' entre vous a déjà fait un test pour du board ?
Vous savez comment ça se passe ? Vos experiences, tout ça .
Moi perso ça dure une journée qui commence à 10h30 donc je me dis, quand même ça va être assez court .
Ah et du coup : Les épisodes de la série durent 13 min . Vous pensez qu' on va me demander de boarder un épisode entier (imaginons qu' on me laisse travailler 7h dessus, ça vous paraît possible qu' on me demande de boucler un épisode entier ?)

En tout cas je pensais faire un exo de board à partir d' un script pour m' entrainer . Puisque j' imagine que c' est ça qu' on va me demander de faire .
J' ai trouvé des scripts de la série avatar, je me suis dis que ça pourrait le faire .
Enfin on doit pouvoir trouver mieux parce que le format de la série My knight and Me fait 13 min . Mais je galere un peu à trouver un script proche de ça (déjà une série fr du coup)

- - - - - - - - - - - - - - -
gueublo   -   présentation sur le forum   -  facebook
Revenir en haut Aller en bas
http://kazeplop.blogspot.com
kwentin
post d'or
post d'or
avatar

Messages : 140
Date d'inscription : 13/05/2012

MessageSujet: Re: STORY BOARD   7/8/2015, 14:04

Hello Kaze !

Je suis à TeamTO en ce moment, sur Angelo saison 3, et pareil j'ai du passer un test avant d'être engagé. Comme My Knight and Me est une série 3D, je ne pense pas qu'ils soient si exigeants que ça sur le respect du model sheet. Sur Angelo (série 3D également), chaque boarder est libre d'utiliser le style de dessin qui lui convient, libre de dessiner les persos comme il veut, à partir du moment où les dessins sont clairs, aux proportions, et un minimum reconnaissables quand même !

En tout cas c'est comme ça que ça marche sur Angelo ; je ne connais pas l'équipe de My Knight and Me, ni leurs exigences, mais sincèrement je ne pense pas qu'il te faille respecter à 100% le design des personnages.

Sinon, en général pour les tests de boards, ils ne demandent que de boarder quelques pages, ils ne te donneront jamais un épisode en entier, c'est impossible à faire en une journée (sur Angelo par exemple on a 3 semaines pour boarder un épisode de 11min30). Là sur une journée ce sera peut-être même une seule page ? Les scripts sur Angelo font en général 18-19 pages pour du 11min30, mais ça peut varier selon les séries.

Par contre je n'ai jamais fait de test sur place, ça a toujours été chez moi pour l'instant, donc je ne peux pas trop te renseigner là-dessus.

Voilà voilà, j'espère pour toi que ça va bien se passer ! En tout cas ça a l'air plutôt sympa comme série ! =)

- - - - - - - - - - - - - - -
http://quentinlebegue.blogspot.com
Revenir en haut Aller en bas
http://quentin-lebegue.tumblr.com
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   7/8/2015, 14:09

jamais un episode entier ce serait du travail dissimulé, refuse tout test de plus de 2 jours (1 jour c la norme), sinon demande a en faire la moitié si possible (gentilment)

pour une serie 2D le dessin doit etre precis
pour une serie 3D, ben comme c en 3D on sen fout des modele effectivement^^

par contre attention aux proportions entre les persos et TOUJOURS bien dessiner le visage par contre pour clarifier les expressions (ainsi que les parties du corps necessaires a l'action (exemple si un perso ouvre une porte ut dois etre precis quant a la main qui empoigne la poignée de porte et la fait pivoter pour l'ouvrir)

mais attention QUOI QUIL ARRIVE on s'en fout pas des layout, des echelles de persos des proportions des persos les un les autres etc, bien placer a l'echelle un perso ds lespace  (cf le thread et l'uv layout)

en moyenne une page de script = 1 minute = entre 30 et 50 plans (c completement a la louche et ça depend du type de mis een scene)
en predecoupage un boarder moyen met une journée pour faire 40 plan de predecoupage (apres ca varie si la serie est compelxe etc)
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
Tian
Raditz
Raditz
avatar

Messages : 717
Date d'inscription : 24/11/2012
Localisation : Empire du Milieu

MessageSujet: Re: STORY BOARD   7/8/2015, 14:45

Courage mec, tu vas l'avoir ce job !

- - - - - - - - - - - - - - -
Parfois, je trouve vraiment des trucs bizarres dans mon dez.


http://cqfd.bbfr.net/t974-presentation-tian
Revenir en haut Aller en bas
http://www.indisponibles.blogspot.com
kaze
Bienveillant_admin
Bienveillant_admin
avatar

Messages : 1371
Date d'inscription : 02/01/2011
Localisation : Toulouse

MessageSujet: Re: STORY BOARD   9/8/2015, 21:13

Merci pour les réponses, ça m' a bien rassuré ^^

Tian a écrit:
Courage mec, tu vas l'avoir ce job !
Franchement je sais pas j' aurai eu besoin de beaucoup plus de temps pour m' entrainer . Mais dans tous les cas j' ai beaucoup appris, et je vais pas m' arrêter là :)



Alors j' ai fait un exercice de board .

J' ai galéré, mis trop de temps, parce que j' ai mal géré . A la base je pensais qu' il fallait boarder quelque chose d' assez long . Je comprenais mal le temps nécessaire pour telle ou telle portion de script .

Donc j' ai commencé à découper sur large . Ca m' a pris du temps . J' aurais du faire moins . Et du coup dans ce que je montre, le début est plus ou moins aboutit (mais il reste encore pas mal de taff au niveau du clean, rendre ça plus précis et rigoureux, et y a pas les ombres) et la suite pas du tout, c' est super rough, je doute que ça soit tres lisible . Et le timing est imprécis .
Excusez moi pour la qualité . J' ai mal geré, mais franchement je découvrais à moitié donc c' était galère d' anticiper le tout .
Et j' ai aussi du réviser tout ce qui est board, langage, découvrir le logiciel, bref, c' était le sprint lol .

Je poste quand même parce que bon je pars demain, et j' avais besoin d' avoir des retours avant .
Dans tous les cas j' aurais beaucoup appris ^^


Bon c' est un peu galère pour avoir un vrai board à montrer sur le net avec Toonboom Storyboard, il n' y avait que l' option pdf, les autres options ne permettaient pas d' avoir les notes et les dialogues en vis à vis .


Le board :

C' est un passage de Batman : The série (des 90s il me semble) .
Episode : Pretty Poison .
Si vous voulez le script :  http://leethomson.myzen.co.uk/Batman/Batman_Animated_Series_1x09_-_Pretty_Poison.pdf
C' est pas super adapté par rapport à la série sur laquelle je postule, mais j' ai eu du mal à trouver des vrais scripts d' anim, interessants (souvent des scripts redigés à partir des épisodes, ce qui m' arrangeait pas)
L' épisode (j' ai pas encore comparé) :


Du coup tant qu' à faire j' ai uploadé une vidéo de mon board :

NOTE :Je viens de me rendre compte avec l' aperçu de la vidéo de l' épisode de batman que les model sheet que j' ai pris en ref sont vraiment different (pourtant j' ai tapé "batman : the serie" avec des designs un peu à la Bruce Timm) ... Donc euh ... voilà faut pas s' étonner si mes persos sont pas exactement les même (big fail) .

EDIT (j' ai continué un peu hier, en ajoutant des gris, je met cette derniere version legerement moins crade ^^")


Et pour les courageux, je laisse à disposition le pdf : http://we.tl/Cdb2prbTfc


Donc voilà .
Si vous avez un peu de temps, hésitez pas à me dire ce que vous en pensez :
- Au niveau du board en lui-même .
- Au niveau du langage board, si j' ai bien fait comme on le fait dans le monde pro
- Et dites moi si je me suis égaré si y a des aspects que j' ai completement zappé et qu' on pourra me demander lors du test, et inversement, si y a des trucs sur lesquels c' était pas la peine de m' emmerder parcequ' on me demandera pas ça pour un test (genre j' ai fait les mouvements de cam avec le logiciel, legerement timer, je sais pas à quel point c' était nécessaire)


A part ça quelques questions, qui me sont venu lors de l' exercice :

- Lors du test, je dois aussi timer les plans, les mouvements de cam ? Ou c' est secondaire (ou à reserver pour la fin)
-  Est-ce que parfois on peut deriver légèrement du script ?
Par exemple j' avais 2 plans séparés dans le script que je trouvais plus interessant fusionnés .
Ou encore parfois on se retrouver à gerer les positions des persos de chaque côté de l' écran, à gerer les 180°, et t' as un plan demandé dans le script qui fout un peu le bordel dans l' organisation . C' est gérable en faisant switcher les persos de place, mais je me dis que ça pourrait être plus simple en contournant un peu les demandes du script .

- Sur toonboom, est-ce que je dois prendre la peine de coller les décors à chaque fois (même quand on reste dans le même plan) ? Et si oui, je dois gommer derrière les persos pour rendre ça plus lisible ou je laisse les traits de constructions ?


Bon encore une fois, je m' excuse de la qualité, autant dans l' aspect que dans la qualité, j' ai mal geré mon temps .
Je prendrai le temps de faire des boards vraiment aboutis pour le futur .

- - - - - - - - - - - - - - -
gueublo   -   présentation sur le forum   -  facebook


Dernière édition par kaze le 10/8/2015, 12:44, édité 3 fois
Revenir en haut Aller en bas
http://kazeplop.blogspot.com
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   10/8/2015, 00:25

tu as mis combien de temps pour faire ce board? combien de temps poru le pre animatiquer?
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
kaze
Bienveillant_admin
Bienveillant_admin
avatar

Messages : 1371
Date d'inscription : 02/01/2011
Localisation : Toulouse

MessageSujet: Re: STORY BOARD   10/8/2015, 00:58

Ben j' ai pas compté . A la louche je dirais un peu moins de 40h

Mais enfin depuis le dernier message donc le 7 aout midi . Je crois que j' avais attaqué quelques heures plus tard, parce que j' ai bien trainer pour trouver un bon script et tout . Puis trouvé le bon passage (j' ai hésité entre plusieurs) . Et j' ai regardé des tutoriaux, tout ça . J' ai du commencé vendredi soir à mon avis .

J' ai essayé de faire ça bien planifié, j' ai lu, relu le script, fait une timeline, un découpage papier thumbnail,etc.

Et puis apres ben j' ai travaillé un peu non-stop depuis .Je pense que je devais faire au moins du 12h/jour.

Ca me paraît un peu excessif comme temps par rapport au résultat . C' est vachement lent non ?
Et le pire c' est que je sens que souvent je me suis depeché sur plein d' étapes alors que je savais qu' il y avait encore pas mal de trucs à travailler .

Enfin je pense pas être lent en general . Je pense juste que fallait que ça rentre et que j' ai passé pas mal de temps à découvrir des trucs, regarder comment on nommait tel truc, comment les autres faisaient, etc. (pourtant j' avais déjà regardé plein de boards mais bon, sans la pratique à côté c' est pas pareil)


Le temps pour la pre animatique je sais pas non plus, parce que j' ai fait le mouvement de cam un peu en même temps que j' avançais (ça me permettait de tester un peu les fonctionalités du logiciel)

- - - - - - - - - - - - - - -
gueublo   -   présentation sur le forum   -  facebook
Revenir en haut Aller en bas
http://kazeplop.blogspot.com
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   10/8/2015, 07:39

combien de page fait le morceau de script que tu as fait?

tu dois etre precis apprendre a evaluer des données si tu veux entrer en prod tu dois rationaliser ton travail car tu n'es pas tout seul a bosser sur un meme projet

donc chaque projet test ue tu soumet en board ; indique le nombre de page du script, le nombre d'heure pour chaque etape pour etre bien evalué

franchement tu as bcp de potentiel y a aucun soucis^^ en plus pour une premiere fois sur toionboom tu as bien eu les choses ne main^^ bravo!  mais je vais etre un peu rude car je n'a pas trop le temps today excuse moi d'avance^^' mais ne te meprend pas c cool d'avoir fait ce test c une bonne base de travail pour tameliorer :)

donc oublie pas c en se trompant qu'on apprend tout va bien c cool ^^ c normal que ut soit pas au point



à vue de nez il s'agit d'une page de script a mon avis?


l'extrait choisit montre tout autre chose que toi.^^'
compare tu verra
On y voit bruce wayne a la table des deux tourteraux, toi tu l'a fait a 10 m^^'

la fille embrasse le mec longtemps mais pas aussi longtemps que toi tu l'a fait
tu as fait eterniser la conversation juste avant aussi

tu utilise des mega courte focales, d'ailleurs la plupart du temps tu fait nimporte quoi avec la focale dsl tu ne reflechit pas du tout à ça^^'



tu ne pourra pas bien boarder si tu ne considere pas ton cadre comme une camera. tu n'es pas en bd mais au cinema


et pas de chance, je vians de tomber sur cet article d'un grand historien du manga qui dit^^
http://www.liberation.fr/livres/2015/08/05/eiji-otsuka-dans-le-manga-le-mouvement-est-roi_1359237

que Tezuka doit tout a Disney et Eisenstein = doit tout au cinema.
le manga ets fort car une case = un plan de cinema

donc MEME si tu te dit rien a foutre du board je retourne a la bd, tu aura bien tort de ne pas te preocuper de la focale ;)


a cause de ces courtes focale tu as des decors de 4 km donc au dela du fait que c faux comme pers tellement c abusay, (les persos devraient etre ultra deformés du coup en consequence hein, si tu fait de la courte focale de la mort pk les persos sont en focale a la cool du coup?), tout simplement uber cher a faire (oui il faut penser a ça aussi ^^)

regarde et compare avec la video c TRES important. compare chaque plan tu va apprendre enormement ainsi

autre probleme : etablie A l'avance la SCENOGRAPHIE (LIS EISENSTEIN) : fait comme un plan au sol ou tu pose tes persos comme ça tu tournera ta camera dans cette scene pre etablie tout simplement ça ca te faciliter considerablement la tache
pour chaque seq tu devras le faire (en prod, tu auras un decors fourni enfin en theorie..)

et dans l'ideal : si tu veux vraiment bien faire (et tu le veux n'est cepas^^) : dessine sans travail de cadrage ni rien ls posing de ces persos d'apres ce plan etabli : COMMENT d'apres toi devrai etre assis bruce wayne et surtout la meuf par rapport a l'autre gars etc. on devrait comprendre rien que par leur posing leur caracter (la meuf super horny soit disans etc) = je te demande de dessine une sorte de shema quoi, une micro illu typique de la sequence que ut veux boarder

car si tu improvise comment son les persos au moment du board tu ne pourra pas tout gerer

le principe de la methode c d'etaler toute les etapes de reflexion dans le temps

le storyboard c de la mise en scene autant que de la sceno autant que de l'acting autant que du montage.
c donc tres difficile de otut penser en meme temps
c un dessin en plus prealable mais il peut derterminer ta maniere de te positionner pendant le predecoupage



autre erreur recurrente chez toi, tu n'evalue pas les distances entre les persos.  plan 17 par exemple la fille a l'air a mille m au dessus du mec etc. la pers est ultra plongeante alors que la meuf est de profil?? (elle devrait etre vue du dessus vu otn angle de vue abusay

ce qu ej'essaie de te dire c que tu ne tient pas compte de l'espace que tu construit pourtant pas si mal^^'


tu n'integre pas tes perso DANS cet espace tu prend des libertés abusay la dessus alors que visiblement quand bien meme tu fasse des focale de malade mental, tes pers sont plutot juste donc c que tu connais els principe^^

je tte conseille de faire l'uv de layout level 0 vite fait avant de passer a autre chose car il va tobliger a re considerer la chose. fais le stp ça dure pas une semaine entiere :)





l'etape la plus importante : le predec:  c une etape NON efficace en terme de rendement : tu dois passer du temps a reflechir faire des thubnail, REGARDER des ref (bouts de films, films entier, screenshoter des films entier ou des seq de film etc), rester le nez vers le plafond a visualiser ton board futur

tu crois que tu fout rien et c culpabilisant mais c indispensable
le storyboard c'est de la mise en scene en vrai, 'cest donc de la reflexion

donc ne te comporte pas comme un executant mais comme un decideur, un preneur d'initiative, quelqu'un qui fait des choix, et pour les faire bien : tu dois prendre du temps pour reflechir



comme je disai considere que un plan de  predec c'est un tableau (de maitre j'entend, un tableau comme dans un musee) = tu dois mettre un certain nombre d'infos.


commence par faire un predecoupage donc, sans developper les acting a l'interieur.

on doit comprendre ce qui sy passe SANS avoir d'acting developpé
. si tu arrives a ça, c ds la poche . ça veut dire que ut as reussi a faire une sorte de tableau ou toute les infos sont la, ou la compo rend l'image lisible etc.^^






donc je te propose pour la prochaine fois de ne faire qu ele predec, le rendre lisible et presentable ici:




si tu fais valider un predec (une serie de plan/tableau) alors tu pourra y developper les acting les posing. = faire un premier book

le fait d'avoir fait seulement une image par plan te fera moins chier a changer que d'avoir tout developpé direct





donc fais le predecoupage d'une sequence sans developper les acting, et determine (en rough/brouillon) la focale de chaque plan dedans.




decris en dessous de chaque case de predecoupage (lisiblement!!) ce qui sy passe (en une phrase courte) pour que je puisse comprendre un minimum.

poste le script sur le forum direct (en spoiler) pour faciliter les choses merci^^)

recapiitulatif :


_ faire l'uv layout level 0
_ tiens et lis eisenstein aussi tant que ty es

_ relis des truc genre prince vaillant, flash gordon, bref des BD ou chaque case = un plan ultra significatif
_ regarde plein de board, serie et film


_ faire seulement le predec et  poste le ici avant de continuer


predecoupage contraintes:

_ BONHOMME PATATE mais chacun a la bonne hauteur et largeur selon le modele sheet. mais pas de details.
_ compositions lisibles
_ rythme (montage, doit tu tout raconter?)
_ en board on doit MONTRER et pas decrire les choses = fait un tableau qui nous fait comprendre les nejeux en un clin d'oeil (litteralement un clin d'oeil)
_ layout = perso bien posés dans l'espace
_ determiner la focale
_ un plan = un tableau, ne pas developper d'acting, ou bien 3 images par plan grand max et ça doti etre justifié
_ proportions des persos les un les autres
_ un storyboard n'est pas une bd = le plaisir du dessin passe apres le fait que le board est un document de travail
tu dois donc apprendre a dessiner simple et lisible ne meme temps, ne pas passer de temps sur le dessin
_ expressions de visage toujours tres claires et lisibles (pas le visage entier, ne fais pas poru autant des cheuveux detaillés etc bien entendu)



pour le moment tu as un bon instinct mais aucune methode^^
donc la j'essaie de t'orienter vers une certaine methode
regarde aussi plein de board pour comprendre c tres important, prend le temps de matter des board de serie ou de film
une fois que tu aura fait un board a peu pres dans les clous on pourra se preocuper plus d'approfondir la narration :)


courage ca te servira quoi quil arrive tout ça que ce soit professionelement bien sur et notamment pour tes  bd a titre perso donc tu as tout a gagner a perseverer  :)
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   10/8/2015, 08:11

en passant voici qq board recup d'ankama notamment (ca a 5 ans donc je pense que tout le monde s'en fout mais merci de pas poster ça en vrac sur le net a la vue de tous sans demander a son proprio merci
je n'ai pas le droit de poster ça publiquement en principe je le fait dans un but unique de pedagogie a titre gratuit


https://copy.com/WG8GGGvAOJwwGPk9

le test board pour kerubin a l'epoque
https://copy.com/Xb9L3wSda99Y4E2y

dautres board
https://copy.com/wUWkHObgoAWX1yZ6

https://copy.com/bHI6o14EXvu1teqD

https://copy.com/n1agkLNfLPzeppS2

https://copy.com/8jGmZlCPKnEHOITJ

https://copy.com/GiQI9LwTEA97IW8N

https://copy.com/tqgwTDfKloHmuRtZ


recupere les et regardeles tous bien un a un
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
kaze
Bienveillant_admin
Bienveillant_admin
avatar

Messages : 1371
Date d'inscription : 02/01/2011
Localisation : Toulouse

MessageSujet: Re: STORY BOARD   10/8/2015, 11:35

Ok merci pour tout, ça va beaucoup m' aider :)
Quand je rentre je fais ça, ça va être bon comme exercice . J' ai besoin de bosser les trucs un peu un par un, ça va me faire du bien .

Le script , la partie entière fait 2,5 pages et la partie que j' ai plus ou moins cleané , 1 page à peu pres .

Oui j' ai vu l' extrait, c' est carrément different je sais ^^ » Je suis parti dans un ton complètement different . (apres bon l' extrait est pas complètement fidèle au script non plus, y a quelques trucs pas suivis)

Les focales, c' est vrai que j' y pense pas beaucoup, et que je fais un peu n' importe quoi .
Pareil pour les intégrations de personnages .
Souvent c' est des trucs dont j' avais conscience mais sur lesquels je me permettaient un peu de tricher en me disant que ça pouvait passer .
Je vais être plus rigoureux là dessus .

Merci encore . J' apprend beaucoup là

PS : je vais lire Eseinstein en rentrant lol promis

- - - - - - - - - - - - - - -
gueublo   -   présentation sur le forum   -  facebook
Revenir en haut Aller en bas
http://kazeplop.blogspot.com
Tian
Raditz
Raditz
avatar

Messages : 717
Date d'inscription : 24/11/2012
Localisation : Empire du Milieu

MessageSujet: Re: STORY BOARD   10/8/2015, 12:05

Je viens de lire ton post, Mylydy, c'est juste méthodiquement trop balleux, tu gères à mort !

Spoiler:
 

- - - - - - - - - - - - - - -
Parfois, je trouve vraiment des trucs bizarres dans mon dez.


http://cqfd.bbfr.net/t974-presentation-tian
Revenir en haut Aller en bas
http://www.indisponibles.blogspot.com
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   10/8/2015, 12:14

de rien tian^^

@kaze : oui tu t'en foutais des focales jusque la je comprend tkt^^ mais dorenavant c tres important jinsiste,  essaye de comprendre le medium ou tu es, l'univers ou tu te situe, le type de travail que tu veux faire

le storyboard c un document de travail, pas un travail d'auteur, c ultra technique et surtout c'est destiné a des gens DIFFERENTS de toi qui vont devoir se baser dessus pour bosser^^


si tu as tes propres regles de perspectives COMMENT veux tu te faire comprendre des autres? comment peuvent ils travailler depuis ton document de travail?^^


l'anime c un travail d'equipe
tu n'es pas tout seul et tu ne dois jamais te permettre de flancher et de manquer de rigueur car c les gens apres toi qui vont morfler


donc tu as pour devoir de gagner en rigueur absolue et tu en est capable tu as de tres bonnes bases

je viens de la bd, j'ai le meme genre de parcours que toi assez autodidacte instinctif etc, ne supporte pas le moule stupide
je te promet pourtant que c un moule ultra benefique  en ce qui concerne le storyboard


oublie pas que comme en bd c la lisibilité de la narration quui prime sur tout.
franquin (qui venait de l'anime/dusney je rappelle et des comics que j'ai cité donc des illustrateur/peintre classique en faite) disait toujours que une planche bd lisible a 5 m c une planche reussie

c pareil en board
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
Pock
Albatoradmin
Albatoradmin
avatar

Messages : 2227
Date d'inscription : 02/01/2011
Age : 23
Localisation : Viborg, DK

MessageSujet: Re: STORY BOARD   10/8/2015, 12:38

Salut Kaze, je n'ai pas grand chose à ajouter à ce que Mylydy a dit (surtout qu'elle est bien plus expérimentée que moi) mais je voulais juste partager un board de gravity falls qui traine sur mon desktop, j'ai retrouvé le scribd qui correspond.
Car c'est super rough, ce n'est pas la passe finale, mais c'est super clair.
http://fr.scribd.com/doc/240688838/Gravity-Falls-Sock-Opera#scribd

Je pense que tu aurais intérêt à dessiner tes décors et pers en gris, comme ça tu gagnes en clarté direct. Ensuite je trouve que tu dessines avec une brosse très fine en multipliant les traits, ça rend les images assez dures à lire parfois. Jouer avec un peu plus de variation dans la pression peut t'aider à simplifier les images.
L'essentiel est de hiérarchiser mieux tes lignes en variant leur épaisseur par exemple. C'est interdit de faire une ligne d'horizon super large alors que tes persos sont dessinés en traits fins :)
C'est fait de manière très simple sur les boards de GF, ça prend vraiment deux sec
Ce qui peut t'aider aussi est de fermer davantage tes traits sur les persos pour définir davantage leur silhouette et les opposer ainsi aux traits du décor. Si tu définis mieux la silhouette en nous montrant clairement les contours d'une masse, on identifiera mieux cette masse

Il y a plus de boulot sur celui là, mais c'est aussi un très bon exemple de simplicité dans les silhouettes et le traitement efficace de l'espace, pas besoin de 5000 traits pour dessiner une grille :) au final ça distrait plus qu'autre chose. Les grilles c'est essentiel mais organiser l'espace, le diviser clairement entre différents plans c'est tout autant important à mon avis :)
http://fr.scribd.com/doc/237133991/Gravity-Falls-the-Bunker

merci pour le partage aussi, c'est cool de voir un peu tout ça !
Bon courage pour la suite !

- - - - - - - - - - - - - - -
Présentation -> http://cqfd.bbfr.net/t68-presentation-pock
Revenir en haut Aller en bas
http://scribbling-things.blogspot.com
dolerf
Bernard Minet
Bernard Minet
avatar

Messages : 244
Date d'inscription : 28/06/2013

Feuille de personnage
Nom ::
Description ::
PV:
7/7  (7/7)

MessageSujet: Re: STORY BOARD   10/8/2015, 16:17

Wow, merci Kaze d'avoir posté ça ici, et merci à Mylydy et à Pock pour toutes ces infos, ressources et ces corrections, on apprend énormément.
Revenir en haut Aller en bas
http://danderdolerf.blogspot.com
Sparkler
Stalkeradmin
 Stalkeradmin
avatar

Messages : 460
Date d'inscription : 28/08/2013
Age : 23
Localisation : À la recherche des dragons balls

MessageSujet: Re: STORY BOARD   10/8/2015, 19:03

OMFG
68IERTGE68IERTGEjuhygtfrdesz3TGE3TGE3TGEkujyhgtrfed:jukiolpmmoliku:jukiolpmmoliku:xcvbhn6452:dfghjklm5T3T/.OI?UNjyfhgdfvcsxjyfhgdfvcsxikujhygtfrgthyujikijoikjuhbgvfcmoikjuhbgvfcmtrytrytrtrytryesgdfswddcsdfrgthyjukiyujh:edsfsfsdfuoluo:sdfsdsdsd:sfsdfsdfsdfsdfsdf

En fait on pourrait mettre tous les smileys en réponse a ce post, ils seraient tous justifies.

- - - - - - - - - - - - - - -
Encore une fois, je vous aime tous.
Spoiler:
 
Revenir en haut Aller en bas
http://vincentchansard.blogspot.fr/
mylydy
fotdefraPAdmin
fotdefraPAdmin
avatar

Messages : 8408
Date d'inscription : 22/12/2010
Age : 35
Localisation : salle du temps

Feuille de personnage
Nom ::
Description ::
PV:
0/999  (0/999)

MessageSujet: Re: STORY BOARD   10/8/2015, 19:09

^^
contente que ça vous aide^^
sparkler quand tas le temps hesite pas a ajouter des smiley de meme en tt genre comme tu sais en trouver si bien :D
zqesdszefd
Revenir en haut Aller en bas
http://mylydy.tumblr.com/
Contenu sponsorisé




MessageSujet: Re: STORY BOARD   

Revenir en haut Aller en bas
 
STORY BOARD
Voir le sujet précédent Voir le sujet suivant Revenir en haut 
Page 11 sur 12Aller à la page : Précédent  1, 2, 3 ... , 10, 11, 12  Suivant
 Sujets similaires
-
» Petite partie du story board de la pub des 15 ans
» Rambo III
» [Animation] les mystérieuse citées d'or reviennent en DVD
» Chemin de fer : comment le présenter ?
» (Entrainement Nemu) Story board et mise en page

Permission de ce forum:Vous ne pouvez pas répondre aux sujets dans ce forum
CQFD :: What do you REALLY wanna know? :: The Best of the Best-
Sauter vers: